.
The Open Protein Structure Annotation Network
PDB Keyword
.

2onf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_393673.1) from Thermoplasma acidophilum at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2onf Target Id 370499
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1569,NP_393673.1, 92422 Molecular Weight 16012.35 Da.
    Residues 139 Isoelectric Point 5.22
    Sequence mhvyesdvswiddrrtevsvgdhrievdsppefggpegqlypetlfpsvlascllttflefkdrmginl kswnshvtaelgpspekgfkfhrikihvkigvndedkekipramqlaekycfisrairnnveeivdyefv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.201
    Matthews' coefficent 2.39 Rfactor 0.162
    Waters 306 Solvent Content 48.58

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2onf

    Protein Summary

    Gene Ta0195 from Thermoplasma acidophilum encodes protein NP_393673 that belongs to the large family of OsmC-like proteins (PF02566, COG1765, and COG1764). Proteins from this family are present mostly in bacteria, but also in protists, slime molds and fungi, are involved in oxidative / osmotic stress response and hydroperoxide detoxification. Interestingly, eukaryotic proteins from this family do not form a common sub-tree and appear to represents independent gene transfer events. In the vicinity of gene Ta0195, a death associated protein kinase related protein is found with score 0.8 (Ta0196)

    According to SCOP, 2onf and its structural similar neighbors (PDB structures [Dali Z score]: PDB:2pn2 [Z=15], PDB:1ml8 [Z=15], PDB:2d7v [Z=16], PDB:1n2f [Z=14], PDB:1qwi [Z=14], PDB:1vla [Z=12], and PDB:2opl [Z=11]) belong to the OsmC-like fold from the alpha+beta class. Other proteins from this family solved by JCSG are Thermotoga maritima protein TM0919 (PDB:1vla, topsan) and Psychrobacter arcticus protein Psyc_0566 (PDB:2pn2, topsan).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch