.
The Open Protein Structure Annotation Network
PDB Keyword
.

2okf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of fdxN element excision controlling factor protein (YP_323815.1) from Anabaena variabilis ATCC 29413 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2okf Target Id 367680
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1521,YP_323815.1, BIG_35, 86295 Molecular Weight 15814.51 Da.
    Residues 139 Isoelectric Point 6.11
    Sequence msardvfhevvktalkkdgwqitddpltisvggvnlsidlaaqkliaaerqgqkiavevksflkqssai sefhtalgqfinyrgalrkvepdrvlylavplttyktffqldfpkeiiienqvkmlvydveqevifqwin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.155
    Matthews' coefficent 2.36 Rfactor 0.142
    Waters 285 Solvent Content 47.96

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2okf

    Protein Summary

    The gene Ava_3312 from Anabaena variabilis encodes a putative XisH family protein PF08814, an FdxN element excision controlling factor protein.  The structure of the close homologue (86% sequence identity) from the Nostoc punctiforme has been solved 2INB.  The protein belongs to the class of alpha and beta (a+b) proteins and adopts a restriction endonuclease-like fold type SCOP52979.  XisH together with the XisF and XisI proteins are required for excision from the chromosome of the fdxN element, along with two other DNA elements, during heterocyst differentiation in cyanobacteria.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch