.
The Open Protein Structure Annotation Network
PDB Keyword
.

2oc6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_388456.1) from Bacillus subtilis at 1.75 A resolution. To be published
    Site JCSG
    PDB Id 2oc6 Target Id 367782
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS1525,NP_388456.1, BIG_439, BIG_25, 86270 Molecular Weight 14417.77 Da.
    Residues 123 Isoelectric Point 5.47
    Sequence mdvfseylagiadpfhrerteevltwiknkypnlhteikwnqpmftdhgtfiigfsvskkhlavapekv tiahveddivkagydyteqliripwngpvdytllekmiefnildkadcstfwrk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.75 Rfree 0.217
    Matthews' coefficent 2.37 Rfactor 0.173
    Waters 191 Solvent Content 48.09

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2oc6
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. A structural and functional homolog supports a general role for frataxin in cellular iron chemistry
    W Qi, JA Cowan - Chemical Communications, 2010 - pubs.rsc.org
     

    Protein Summary

    The ydhG (BSU05750) gene from Bacillus subtilis codes for the NP_388456 protein that belongs to DUF1801 (PF08818) and it has sequence similarity to the uncharacterized COG5646. The ydhG gene has predicted (string.embl.de) functional associations with: iolD (Probable malonic semialdehyde oxidative decarboxylase), E83C (Protein iolC), and E83B (Protein iolB).

    SCOP classifies 2oc6 inside the alpha+beta class, secretion chaperone-like fold, YdhG-like (super)family. DALI top hits are with the BH2032 protein PDB:2kl4 (Z=18),  and the uncharacterized protein PDB:2i8d (Z=9). FATCAT detects structural similarity to the NADH quinone oxidireductase subunit-I PDB:3iam (Z=8).

    A functional similarity to the frataxin family supporting a general cellular role for frataxin-type proteins in cellular iron homeostasis has been proposed [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch