The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of XisI protein-like (YP_323822.1) from Anabaena Variabilis ATCC 29413 at 1.85 A resolution. To be published
    Site JCSG
    PDB Id 2nwv Target Id 367681
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1522,YP_323822.1, BIG_402, BIG_57, 86301 Molecular Weight 13425.40 Da.
    Residues 113 Isoelectric Point 4.87
    Sequence mdnvaeyrklikqvlteydnlsrqspetnyetclvfdenhdnylwlavdwqgskrikytyvhiriknek iyieedyteegiatelmrlgvtnndivlafhppdvrkftdfata
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.225
    Matthews' coefficent 2.85 Rfactor 0.192
    Waters 76 Solvent Content 56.91

    Ligand Information


    Google Scholar output for 2nwv

    Protein Summary

    Annotated as XisI protein like. No significant similarity to Pfam families. Top conserved residues are: Trp50, Tyr43, Tyr71, His62, Asp37, Asp75, and several Ile/Leu/Val. It has DALI top hits to protein with almost identical structure - XisI protein-like (PDB code 2nlv), and several other proteins with similar structure: aldehyde oxidoreductase (PDB code 1dgj), and prolyl-tRNA synthetase (PDB code 2j3l).

    Ligand Summary





    No references found.

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch