.
The Open Protein Structure Annotation Network
PDB Keyword
.

2nlv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of XisI protein-like (YP_324325.1) from Anabaena Variabilis ATCC 29413 at 1.30 A resolution. To be published
    Site JCSG
    PDB Id 2nlv Target Id 367696
    Molecular Characteristics
    Source Anabaena variabilis atcc 29413
    Alias Ids TPS1523,YP_324325.1, BIG_402, BIG_57, 86302 Molecular Weight 13104.34 Da.
    Residues 111 Isoelectric Point 5.05
    Sequence mdklvkyqelvkklltnyasddvsdqdvevqlildternhyqwmnvgwqglnriyrcvihfdikdgkiw lqqnltdrnpaeelvmmgvpredivlglqapykrqytdygva
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.30 Rfree 0.195
    Matthews' coefficent 2.06 Rfactor 0.175
    Waters 296 Solvent Content 40.21

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2nlv
    1. Modeling discrete heterogeneity in X-ray diffraction data by fitting multi-conformers
    H Van Den Bedem, A Dhanik, JC Latombe - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Modeling structural heterogeneity in proteins from X-ray data
    A Dhanik, H Van Den Bedem, A Deacon - Algorithmic Foundation of , 2009 - Springer
     

    Protein Summary

    The AVA3825 gene from A. variabilis ATCC 29413 encodes the YP_324325 amino acid sequence belonging to the XisI-like proteins (fdxN element excision controlling factor protein) (PF08869). It has weak structural similarity to aldehyde oxidoreductase (PDB structure 1dgj; DALI Z-score = 5.4; RMSD = 2.3; 3% sequence identity for 59 superimposed residues). The most conserved residues are Trp48 and Trp69  (both are located next to two different  clefts).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch