.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kzf

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR structure of the thermotoga maritima protein TM0855. To be Published
    Site JCSG
    PDB Id 2kzf Target Id 282725
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2155,TM0855, 84892 Molecular Weight 15546.15 Da.
    Residues 131 Isoelectric Point 7.83
    Sequence mnpayrkamleseiqkllmealqqlrdprlkkdfvtfsrvelskdkryadvyvsflgtpeerketveil nrakgffrtfiaknlrlyvapeirfyedkgieasvkvhqllvqlgydplkdkekkeedkeee
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kzf

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch