.
The Open Protein Structure Annotation Network
PDB Keyword
.

2kyz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NMR structure of heavy metal binding protein TM0320 from Thermotoga maritima. To be Published
    Site JCSG
    PDB Id 2kyz Target Id 282196
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2036,TM0320, 323448 Molecular Weight 7852.65 Da.
    Residues 67 Isoelectric Point 4.78
    Sequence mryvlyvpdiscnhckmriskaleelgvknyevsveekkvvvetenldsvlkkleeidypvesyqev
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2kyz
    1. The J-UNIO protocol for automated protein structure determination by NMR in solution
    P Serrano, B Pedrini, B Mohanty, M Geralt - Journal of biomolecular , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch