.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ka7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title The J-UNIO protocol for automated protein structure determination by NMR in solution. To be Published
    Site JCSG
    PDB Id 2ka7 Target Id 282092
    Related PDB Ids 1zko 
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1191,TM0212, 84858 Molecular Weight 13913.92 Da.
    Residues 124 Isoelectric Point 4.40
    Sequence mkmkkytkthewvsiedkvatvgitnhaqeqlgdvvyvdlpevgrevkkgevvasiesvkaaadvyapl sgkivevnekldtepelinkdpegegwlfkmeisdegeledlldeqayqefcaqe
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ka7
    1. The J-UNIO protocol for automated protein structure determination by NMR in solution
    P Serrano, B Pedrini, B Mohanty, M Geralt - Journal of biomolecular , 2012 - Springer
     

    Protein Summary


    The TM0212 gene from Thermotoga maritima codes for the glycine cleavage system H protein  (NP_228027; EC classification: EC:1.4.4.2; ortholog gene cluster COG0509).  

    SCOP classifies 2ka7 inside the all beta class, single hybrid motif superfamily, biotinyl/lipoyl-carrier protein family. 2ka7 is the solution structure PDB code for the 1.65A resolution crystal structure deposited as (1ZKO). Using 2ka7/1zko as query, Dali top hits with Z-scr=23 are with glycine cleavage system H proteins 1onl, 3a7l and 1hpc.

     

    The protein belongs to the biotinyl-lipoyl domain superfamily PF01597.  This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes. GCV catalyses the catabolism of glycine in eukaryotes. A lipoyl group is attached to a completely conserved lysine residue (Lys 60 in 2ka7). The H protein shuttles the methylamine group of glycine from the P protein to the T protein [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch