.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iub

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal Structure of a Divalent Metal Ion Transporter Cora at 2.9 Angstrom Resolution. Science 313 354 2006
    Site JCSG
    PDB Id 2iub Target Id 282434
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1215,TM0561, 84912 Molecular Weight 41444.14 Da.
    Residues 351 Isoelectric Point 5.41
    Sequence meekrlsakkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgihr tdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseqvsliltkncvlm fqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvllekiddeidvleeevlerpeket vqrthqlkrnlvelrktiwplrevlsslyrdvpplieketvpyfrdvydhtiqiadtvetfrdivsgll dvylssvsnktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf kkkkwl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 10
    Resolution (Å) 2.90 Rfree 0.291
    Matthews' coefficent 2.9 Rfactor 0.260
    Waters 13 Solvent Content 57.2

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2iub
    1. Coiled coils: attractive protein folding motifs for the fabrication of self-assembled, responsive and bioactive materials
    B Apostolovic, M Danial, HA Klok - Chem. Soc. Rev., 2010 - xlink.rsc.org
     
    2. An iris-like mechanism of pore dilation in the CorA magnesium transport system
    N Chakrabarti, C Neale, J Payandeh, EF Pai - Biophysical journal, 2010 - Elsevier
     
    3. Structures of membrane proteins
    KR Vinothkumar, R Henderson - Quarterly reviews of , 2010 - Cambridge Univ Press
     
    4. Declines in funding of NIH R01 research grants
    HG Mandel, ES Vesell - Science, 2006 - sciencemag.org
     
    5. Crystal structures of all-alpha type membrane proteins
    K McLuskey, AW Roszak, Y Zhu, NW Isaacs - European Biophysics , 2010 - Springer
     
    6. PoreWalker: a novel tool for the identification and characterization of channels in transmembrane proteins from their three-dimensional structure
    M Pellegrini-Calace, T Maiwald - PLoS computational , 2009 - dx.plos.org
     
    7. There is a baby in the bath water: AcrB contamination is a major problem in membrane-protein crystallization
    D Veesler, S Blangy, C Cambillau - Section F: Structural , 2008 - scripts.iucr.org
     
    8. Structural Dynamics of the Magnesium-Bound Conformation of CorA in a Lipid Bilayer
    O Dalmas, LG Cuello, V Jogini, DM Cortes, B Roux - Structure, 2010 - Elsevier
     
    9. Leishmania major CorA-like magnesium transporters play a critical role in parasite development and virulence
    Y Zhu, A Davis, BJ Smith, J Curtis - International journal for , 2009 - Elsevier
     
    10. Identification of domains in protein crystal structures
    O Carugo - Journal of Applied Crystallography, 2007 - scripts.iucr.org
     
    11. Application of language technologies in biology: Feature extraction and modeling for transmembrane helix prediction
    MK Ganapathiraju - 2007 - lti.cs.cmu.edu
     
    12. The CorAMg2+ Channel
    ME Maguire - Encyclopedia of Inorganic and Bioinorganic , 2008 - Wiley Online Library
     
    13. IRBs: going too far or not far enough?
    DL Felten - Science, 2006 - sciencemag.org
     
    14. Initial Binding of Ions to the Interhelical Loops of Divalent Ion Transporter CorA: Replica Exchange Molecular Dynamics Simulation Study
    T Zhang, Y Mu - PLoS ONE, 2012 - dx.plos.org
     
    15. The Periplasmic Loop Provides Stability to the Open State of the CorA Magnesium Channel
    I Palombo, DO Daley, M Rapp - Journal of Biological Chemistry, 2012 - ASBMB
     
    16. Understanding structure and function of membrane protein transporters
    AK Lundbck - 2008 - diss.kib.ki.se
     
    17. Recent Progress of Bioinformatics in Membrane Protein Structural Studies
    HB Shen, JF Wang, LX Yao, J Yang - in Proteomics and , 2009 - Wiley Online Library
     
    18. A Combination of Compositional Index and Genetic Algorithm for Predicting Transmembrane Helical Segments
    N Zaki, S Bouktif, S Lazarova-Molnar - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    The gene TM0561 from Thermotoga maritima encodes CorA Mg2+ transporter protein (the CorA superfamily PF01544 COG0598).  The crystal structure of the protein has been previously deposited at the PDB database (2BBJ), though at lower resolution.  The CorA family of magnesium transporters is the primary Mg2+ uptake system of most prokaryotes and a functional homologue of the eukaryotic mitochondrial magnesium transporter.  The CorA transport system is the primary Mg2+ influx system of Salmonella typhimurium and Escherichia coli. The transporter is a funnel-shaped homopentamer with two transmembrane helices per monomer. The channel is formed by an inner group of five helices and putatively gated by bulky hydrophobic residues. 

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch