The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (ZP_00107633.1) from Nostoc punctiforme PCC 73102 at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2inb Target Id 368168
    Molecular Characteristics
    Source Nostoc punctiforme pcc 73102
    Alias Ids TPS1535,NPUN_22DEC03_CONTIG1_REVISED_GENENPF2941, BIG_35, 86482 Molecular Weight 15903.53 Da.
    Residues 139 Isoelectric Point 5.44
    Sequence msakdvfhqvvkialekdgwqitndpltisvggvnlsidlgaekliaaeregekiavevksflerssai sefhtalgqfinyrgalrrrqpervlylavplttyktffqldfpkemiaenqvkmliydveqevifqwin
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.191
    Matthews' coefficent 2.27 Rfactor 0.158
    Waters 137 Solvent Content 45.86

    Ligand Information


    Google Scholar output for 2inb
    1. Image-based crystal detection: a machine-learning approach
    R Liu, Y Freund, G Spraggon - Acta Crystallographica Section D: , 2008 - scripts.iucr.org

    Protein Summary

    Nostoc punctiforme hypothetical protein Npun02006528 (Zp_00107633) represents a family of recombination directionality factors (RDFs) from nitrogen fixing bacteria. It is a first structure from this family, shows unexpected structural similarity to endonucleases, despite low sequence similarity (~12% seq id).

    It has the highest structural similarity to PDB structures 1y88 (DALI Z-score 8.6; RMSD 3.0; 14% sequence identity for 104 superimposed residues), 1xmx (DALI Z-score 6.8, RMSD 3.3), 2ixs (DALI Z-score 5.9; RMSD 3.3), 1gef (DALI Z-score 5.9, RMSD 2.8), 2fok (DALI Z-score 5.8, RMSD 3.0), 2czr (DALI Z-score 5.8; RMSD 2.5).

    Analysis of the crystallographic packing using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch