The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal Structure of Acetamidase (10172637) from Bacillus Halodurans at 1.95 A Resolution. To be Published
    Site JCSG
    PDB Id 2ii1 Target Id 356726
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1366,10172637, PF03069, 289690, 289674 Molecular Weight 31862.76 Da.
    Residues 300 Isoelectric Point 4.64
    Sequence mirlsnentiffmdkenvpiascqsgdtvifetkdcfsdqitneeqaltsidfnrvnpatgplyvegar rgdmleieildikvgkqgvmtaapglgalgeslnspttklfpiegddvvystglrlplqpmigvigtap pgepinngtpgphggnldtkdikpgttvylpvevdgallalgdlhaamgdgeilicgveiagtvtlkvn vkkermfplpalktdthfmtiasaetldaaavqatknmatflanrtalsieeagmllsgagdlyvsqiv nplktarfslalhyfeklgvdlcn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.228
    Matthews' coefficent 2.15 Rfactor 0.175
    Waters 443 Solvent Content 42.27

    Ligand Information


    Google Scholar output for 2ii1
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
    2. On the combination of molecular replacement and single-wavelength anomalous diffraction phasing for automated structure determination
    S Panjikar, V Parthasarathy, VS Lamzin - Section D: Biological , 2009 - scripts.iucr.org
    3. Crystal Structure Analysis of a Recombinant Predicted Acetamidase/Formamidase from the Thermophile Thermoanaerobacter tengcongensis
    M Qian, Q Huang, G Wu, L Lai, Y Tang, J Pei - The Protein , 2012 - Springer

    Protein Summary

    The 10172637 from B. halodurans belongs to Acetamidase/Formamidase protein family (PF03069) with homologs present in all kingdoms of life.

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch