The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of TetR-family transcriptional regulator (YP_049917.1) from Erwinia Cartovora Atroseptica SCRI1043 at 1.64 A resolution. To be published
    Site JCSG
    PDB Id 2hyt Target Id 367950
    Molecular Characteristics
    Source Erwinia carotovora subsp. atroseptica scri1043
    Alias Ids TPS1529,YP_049917.1, BIG_4, 90821 Molecular Weight 21658.35 Da.
    Residues 196 Isoelectric Point 5.01
    Sequence mvrrtraemeetratllatarkvfsergyadtsmddltaqasltrgalyhhfgdkkgllaavveqidae mderlqaisdtaeddwegfrcrcraylemalepeiqrivlrdaravlggaspdsqrhcvesmqrlidnl irqgvvaeadpqalasliygslaeaafwiaegedgnarlaqgvaalelllrgllvkpr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.64 Rfree 0.201
    Matthews' coefficent 2.52 Rfactor 0.163
    Waters 292 Solvent Content 51.22

    Ligand Information


    Google Scholar output for 2hyt

    Protein Summary

    The YP_049917 from E. carotovora atroseptica SCRI1043 - has region of similarity (between Leu16 and Val62) to bacterial regulatory proteins, from tetR family (Pfam00440).

    Analysis of the crystallographic packing of YP_049917 using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch