The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structures of MW1337R and lin2004: representatives of a novel protein family that adopt a four-helical bundle fold. Proteins 71 1589-1596 2008
    Site JCSG
    PDB Id 2huj Target Id 367190
    Molecular Characteristics
    Source Listeria innocua clip11262
    Alias Ids TPS1504,NP_471338.1, 90902 Molecular Weight 14650.94 Da.
    Residues 121 Isoelectric Point 5.45
    Sequence mellirteqlllqneknwelylsnreeekpfdfykdmkpfvdeakrcaddflelaipwvnterppylge lqlrqacdnvqmtavsafngrsfykhfldhyqstkytltrvrdflkrkeesm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.74 Rfree 0.207
    Matthews' coefficent 3.00 Rfactor 0.173
    Waters 97 Solvent Content 58.66

    Ligand Information


    Google Scholar output for 2huj
    1. Towards structure-based protein drug design
    C Zhang, L Lai - Biochemical Society Transactions, 2011 - www-06.all-portland.net
    2. Crystal structures of MW1337R and lin2004: Representatives of a novel protein family that adopt a four_helical bundle fold
    P Kozbial, Q Xu, HJ Chiu, D McMullan - Proteins: Structure, , 2008 - Wiley Online Library

    Protein Summary

    The lin2004 gene from Listeria innocua encodes the NP_471338 protein from the DUF1798 family (PF08807, cl07423). More information is provided in its orthologous protein entry 2ets [Ref].

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch