.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hsb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (NP_069135.1) from Archaeoglobus Fulgidus at 1.95 A resolution. To be published
    Site JCSG
    PDB Id 2hsb Target Id 367071
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS1499,NP_069135.1, 90918 Molecular Weight 14541.90 Da.
    Residues 125 Isoelectric Point 6.74
    Sequence mdelelrirkaeklvqdakkefemglyerccstayyamfhaakamllgygrdskthrgtiyliwecree lglsdddcsklsrafdlreesdygiykevskdlaikilkdaeifvqkaknavnknr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.21
    Matthews' coefficent 2.32 Rfactor 0.184
    Waters 47 Solvent Content 46.47

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hsb
    1. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    2. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    3. Plasmodium vivax tryptophan-rich antigen PvTRAg33. 5 contains alpha helical structure and multidomain architecture
    H Bora, S Garg, P Sen, D Kumar, P Kaur, RH Khan - PloS one, 2011 - dx.plos.org
     
    4. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    5. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary

    The AF_0298 gene of A. fulgidus encodes the NP_069135 protein belonging to the higher eukaryotes and prokaryotes nucleotide-binding domain (HEPN) group (PF05168) and to the COG1895.

    SCOP classifies 2hsb inside the HEPN domain family. The 2hsb has a structure similar to proteins with four-helical up-and-down bundle fold, such as the HEPN domain protein (PDB: 1o3u-A; DALI Z-score 13.9; RMSD 2.2; 16% sequence identity within 102 superimposed residues), and the hypothetical protein YutE (PDB:1ylm-A; DALI Z-score 10.5; RMSD 2.8; 7% sequence identity within 113  superimposed residues).

    Analysis of the crystallographic packing of 2hsb using the PQS server {Henrick, 1998 #73} indicates that a monomer is the likely biologically relevant form.

    Ligand Summary

    The cluster of conserved residues (Tyr35, Try36, Phe39, His40, Arg87, and Tyr92) is located close to one of the sulfate binding sites. It is possible that in native environment, molecule other then sulphate is bound in this region. It is unknown whether those conserved residues (located on the positively charged side of this protein) can bind nucleic acids phosphate backbone.

    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch