.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hq7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Protein related to general stress protein 26(GS26) of B.subtilis (pyridoxinephosphate oxidase family) (NP_350077.1) from CLOSTRIDIUM ACETOBUTYLICUM at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2hq7 Target Id 366858
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS1480,NP_350077.1, 2.30.110.10, 29346794, 90877 Molecular Weight 16969.69 Da.
    Residues 145 Isoelectric Point 5.62
    Sequence midekfliesnelvesskivmvgtngengypnikammrlkhdglkkfwlstntstrmverlkknnkicl yfvddnkfaglmlvgtieilhdraskemlwtdgceiyyplgiddpdytalcftaewgnyyrhlknitfk ideiyny
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.242
    Matthews' coefficent 2.07 Rfactor 0.191
    Waters 141 Solvent Content 40.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2hq7
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Domain definition and target classification for CASP7
    ND Clarke, I Ezkurdia, J Kopp, RJ Read - Proteins: Structure, , 2007 - Wiley Online Library
     
    3. Advances in Rosetta protein structure prediction on massively parallel systems
    S Raman, B Qian, D Baker - IBM Journal of Research , 2008 - ieeexplore.ieee.org
     
    4. Reconstruction of Protein Backbone with the alpha-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - Journal of Information Science , 2010 - etd.lib.nsysu.edu.tw
     
    5. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     
    6. Reconstruction of Protein Backbone with the a-Carbon Coordinates
    JH Wang, CB Yang, CT Tseng - 2007 - asiair.asia.edu.tw
     
    7. Refinement of All-atom Backbone Prediction of Proteins
    HY Chang - 2008 - etd.lib.nsysu.edu.tw
     

    Protein Summary

    The NP_350077 of C. acetobutylicum encodes a member of COG3871 (uncharacterized stress protein; general stress protein 26) with predicted functional associations (string.embl.de) with the following proteins: Q97TI6 (endo-1,4-?-xylanase XynD B.subtilis ortholog), Q97D82 (rubrerythrin), Q97D83 (rubrerythrin), Q97TI7 (possible beta-xylosidase, family 43 of glycosyl hydrolases), Q97FS8 (uncharacterized conserved membrane protein).

    The protein structure of NP_350077 is simialar to proteins from SCOP superfamily: FMN-binding split barrel [50475], such as for example: general stress protein (PDB: 2fhq-A Z-score 16.6; RMSD 2.3 27% sequence identity within 126 superimposed residues), general stress protein of COG3871 (PDB: 2i02-A Z-score 14.7; RMSD 3.0 19% sequence identity 130 superimposed residues), hypothetical protein (PDB: 2arz-A Z-score 13.2; RMSD 2.5 8% sequence identity 128 superimposed residues), and hypothetical protein (PDB: 2iab-A Z-score 12.2; RMSD 2.6 14% sequence identity 126 superimposed residues).

    Analysis of the crystallographic packing of FG7279A using the PQS server {Henrick, 1998 #73} indicates that a dimer is the biologically relevant form.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch