.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gvi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (10640422) from THERMOPLASMA ACIDOPHILUM at 1.87 A resolution. To be published
    Site JCSG
    PDB Id 2gvi Target Id 361192
    Molecular Characteristics
    Source Thermoplasma acidophilum dsm 1728
    Alias Ids TPS1466,10640422, PF02663, 90577 Molecular Weight 23080.09 Da.
    Residues 203 Isoelectric Point 6.13
    Sequence meklnfgipewafefhghkcpympmgyragsyalkiaglekekdhrtyllsemspedmngcfndgaqaa tgctygkglfsllgygklalilyrpgrkairvhvrnsfmdelstrasdffryrkqgyepseipagaidp vlewissledeeifeyreidgftfepvkkngakvrcdvcgeytyeadakllngkpvckpdyygkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.87 Rfree 0.217
    Matthews' coefficent 2.87 Rfactor 0.19
    Waters 129 Solvent Content 56.79

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gvi
    1. Ligands in crystal structures that aid in functional characterization
    AE Speers, BF Cravatt - Acta Crystallographica Section F: Structural , 2010 - scripts.iucr.org
     
    2. Structures of three members of Pfam PF02663 (FmdE) implicated in microbial methanogenesis reveal a conserved+ core domain and an auxiliary C-terminal treble-
    HL Axelrod, D Das, P Abdubek, T Astakhova - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The gene Ta1109 from Thermoplasma acidophilum encodes the NP_394568 protein, a putative subunit E of the formylmethanofuran dehydrogenase PF02663 EC:1.2.99.5 COG2191.  

    The 2gvi structure belongs to the class of alpha and beta (a+b) proteins and reveals FmdE/GAPDH domain-like fold SCOP55346, inside the FmdE-like (super)family. The structure of homologous enzyme from Desulfitobacterium hafniense has been solved by Jcsg (PDB:2glz, Z=16, see Topsan).  Another structure similar to 2gvi is the tungsten formylmethanofuran dehydrogenase PDB:3d00 (Z=12).

    The Fmd enzyme  catalyzes the reaction: formylmethanofuran + H2O + acceptor --> CO2 + methanofuran + reduced acceptor.  It requires  2 cofactors: molybdenum or tungsten, and pterin.  This enzyme participates in folate biosynthesis.  

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch