The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (np_346487.1) from Streptococcus pneumoniae TIGR4 at 2.10 A resolution. To be published
    Site JCSG
    PDB Id 2go7 Target Id 359637
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS1425,NP_346487.1, 85241 Molecular Weight 23489.09 Da.
    Residues 206 Isoelectric Point 4.61
    Sequence mqktafiwdldgtlldsyeailsgieetfaqfsipydkekvrefifkysvqdllvrvaedrnldvevln qvraqslaeknaqvvlmpgarevlawadesgiqqfiythkgnnaftilkdlgvesyfteiltsqsgfvr kpspeaatylldkyqlnsdntyyigdrtldvefaqnsgiqsinflestyegnhriqaladisrifetk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.10 Rfree 0.209
    Matthews' coefficent 3.12 Rfactor 0.171
    Waters 492 Solvent Content 60.25

    Ligand Information


    Google Scholar output for 2go7
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org

    Protein Summary

    The gene SP2064 from Streptococcus pneumoniae tigr4 encodes the NP_346487 protein, a putative phosphoglycolate phosphatase (99% sequence identity with a homologue from Streptococcus pneumoniae Hungary19A-6) EC:, and member of the haloacid dehalogenase(HAD)-like hydrolases superfamily PF00702. The enzyme participates in glyoxylate and dicarboxylate metabolism.

    The enzyme catalyzes the following reaction: 2-phosphoglycolate + H(2)O <=> glycolate + phosphate.  

    2go7 belongs to the class of alpha and beta (a+b) proteins and adopts a  HAD-like fold type SCOP56783.  As detected by DALI, several similar structures of the enzyme homologues from different organism have been determined: 2yy6 (Z=23);  2HDO (Z=21), Lactobacillus plantarum; 1TE2 (Z=19), Escherichia coli; 1WR8 (Z=11), Pyrococcus horikoshii.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch