.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gno

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of DNA polymerase III, gamma subunit-related protein (tm0771) from Thermotoga maritima at 2.00 A resolution. To be published
    Site JCSG
    PDB Id 2gno Target Id 360384
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1447,TM0771 Molecular Weight 35235.91 Da.
    Residues 304 Isoelectric Point 5.83
    Sequence akdqletlkriieksegisilingedlsyprevslelpeyvekfppkasdvleidpegenigiddirti kdflnyspelytrkyvivhdcermtqqaanaflkaleeppeyavivlntrrwhyllptiksrvfrvvvn vpkefrdlvkekigdlweelpllerdfktaleayklgaeklsglmeslkvletekllkkvlskglegyl acrellerfskveskeffalfdqvtntitgkdaflliqrltriilhentwesvedqksvsfldsilrvk ianlnnkltlmnilaihrerkrgvnaws
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.278
    Matthews' coefficent 2.31 Rfactor 0.22
    Waters 107 Solvent Content 46.22

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gno
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    Gene TM_0771 from Thermotoga maritima encodes the amino acid sequence NP_228580, containing two domains (1-200 and 201-306), and annotated as DNA polymerase III, gamma (clamp loader) subunit related protein. It is functionally linked by co-ocurrence to the dnaE gene coding for the DNA polymerase III subunit alpha (TM_0461).

     SCOP classifies the N-terminal domain in the alpha/beta class, P-loop containing nucleoside triphosphate hydrolase superfamily, extended AAA ATPase domain family; the C-terminal in the all alpha class, post AAA+ oligomerization domain like superfamily, DNA polymerase III clamp loader subunit family.

    2gno has significant structural similarity to previously characterised structures PDB:1a5t (Z=17), PDB:1njf (Z=14), and PDB:1jr3 (Z=16), but sequence similarity to those structures is only: 22%, 20%, and 21% respectively (click for results of FATCAT and FFAS03 analysis).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch