.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ghr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of homoserine O-succinyltransferase from Bacillus cereus at 2.4 A resolution. Proteins 68 999-1005 2007
    Site JCSG
    PDB Id 2ghr Target Id 360725
    Molecular Characteristics
    Source Bacillus cereus atcc 10987
    Alias Ids TPS1452,NP_981826.1, PF04204, 60680117, 90728 Molecular Weight 35338.44 Da.
    Residues 301 Isoelectric Point 5.69
    Sequence mpiiidkdlparkvlqeenifvmtkeraetqdiralkiailnlmptkqeteaqllrligntplqldvhl lhmeshlsrnvaqehltsfyktfrdienekfdgliitgapvetlsfeevdyweelkrimeysktnvtst lhicwgaqaglyhhygvqkyplkekmfgvfehevreqhvkllqgfdelffaphsrhtevresdirevke ltllanseeagvhlvigqegrqvfalghseyscdtlkqeyerdrdkglnidvpknyfkhdnpnekplvr wrshgnllfsnwlnyyvyqetpyvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.40 Rfree 0.25
    Matthews' coefficent 2.44 Rfactor 0.188
    Waters 78 Solvent Content 54.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ghr
    1. PSI-2: structural genomics to cover protein domain family space
    BH Dessailly, R Nair, L Jaroszewski, JE Fajardo - Structure, 2009 - Elsevier
     
    2. Toward better refinement of comparative models: predicting loops in inexact environments
    BD Sellers, K Zhu, S Zhao, RA Friesner - Proteins: Structure, , 2008 - Wiley Online Library
     
    3. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    4. Amino acid biosynthesis: new architectures in allosteric enzymes
    G Curien, V Biou, C Mas-Droux - Plant Physiology and , 2008 - Elsevier
     
    5. Identification of catalytic cysteine, histidine, and lysine residues in Escherichia coli homoserine transsuccinylase
    K Ziegler, SM Noble, E Mutumanje, B Bishop - Biochemistry, 2007 - ACS Publications
     
    6. Mink Growth Hormone StructuralFunctional Relationships: Effects of Renaturing and Storage Conditions
    V Borromeo, J Sereikaite, VA Bumelis, C Secchi - The Protein , 2008 - Springer
     
    7. Crystal structure of homoserine O_succinyltransferase from Bacillus cereus at 2.4 resolution
    C Zubieta, S Krishna, D McMullan - Proteins: Structure, , 2007 - Wiley Online Library
     
    8. Different Active_Site Loop Orientation in Serine Hydrolases versus Acyltransferases
    Y Jiang, KL Morley, JD Schrag - ChemBioChem, 2011 - Wiley Online Library
     
    9. Assessing the roles of essential functional groups in the mechanism of homoserine succinyltransferase
    DM Coe, RE Viola - Archives of biochemistry and biophysics, 2007 - Elsevier
     
    10. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary

    Bacillus cereus ATCC 10987 encodes a homoserine O-succinyltransferase (Pfam04204; cd03131; EC 2.3.1.46) that catalyses the first step in the biosynthesis of methionine. JCSG has also determined the structure of a related protein from Thermotoga maritima (PDB 2H2W). Structure of similar proteins (determined with FATCAT and FFAS03): 1o1yA, 2a9vA, 1qdlB, 1i1qB, 1i7qB, 1kxjA, 1wl8A, 1ka9H, 2abwA, 1bxrB, 1q7rA1r9gA, 1l9xA, 1s1mA, 1gpmA, 1vcmA, 1vhqA, 1g2iA, 1pdvA, 1rw7A, 2ab0A, 1oi4A, 2fexA, and 1u9cA.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch