.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gfg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of the protein BH2851 (10175472) from Bacillus halodurans at 2.12 A resolution. To be published
    Site JCSG
    PDB Id 2gfg Target Id 359067
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1413,10175472, _0044.000266_, 289541 Molecular Weight 22050.82 Da.
    Residues 192 Isoelectric Point 5.84
    Sequence mgkeieierktlvsketfkrlisqlhigegdfklqrnhyfetddfqlkkqssalrirekeaiftftlkq phpaglletnqtlskqeaklalesahfpsgevmdalrdlsipisqlkhigtlstsraeisyeqgilcld hssylgiedyeiefegtseehatvtfqeilktfsisqvptenkiqrffskkekn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.12 Rfree 0.274
    Matthews' coefficent 2.23 Rfactor 0.225
    Waters 259 Solvent Content 44.46

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gfg
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     

    Protein Summary

    The gene BH2851 from Bacillus halodurans encodes the protein NP_243717.  The sequence alignment identifies the presence of a CYTH domain observed in the adenylate cyclase family (PF01928). SCOP classifies 2gfg inside the CYTH-like phosphatases superfamily, CYTH domain family.

    The structure of 2gfg is similar (Dali Z-scr=15) to that of adenylate cyclase class IV (AC4) from Yersinia pestis PDB:3ghx.  The Yersinia pestis AC4 structure shows the complex of the enzyme with its product, ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE (cAMP).  cAMP is the product of ATP cyclization by AC4 EC:4.6.1.1. The Bacillus halodurans structure was co-crystallized with an unknown ligand, which is located in the binding pocket of cAMP. A second Dali hit is with yet another AC4 structure, PDB:2een from Pyrococcus Horikoshii. It is annotated by the authors of the structure  as hypothetical protein PH1819. A promising candidate for comparison is given by PDB:3n10 an adenylate cyclase IV released on May 14, 2010. It includes cAMP and shares 139 equivalent residues with an rmsd of 2.56Å and 19% sequence identity using TopMatch for structure comparison. It is very plausible that 2gfg represents another AC4 homologue.  The AC4 has a distinct fold from that of AC classes II and III  [Ref].  

    cAMP is an important signaling molecule in virtually all prokaryotic and eukaryotic cells.  In prokaryotes cAMP is a catabolite derepression signal used to trigger the expression of metabolic pathways such as the lactose operon that are otherwise idle when glucose is plentiful.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch