.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gc9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of p-coumaric acid decarboxylase (NP_786857.1) from Lactobacillus plantarum at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2gc9 Target Id 360800
    Molecular Characteristics
    Source Lactobacillus plantarum wcfs1
    Alias Ids TPS1453,NP_786857.1, PF05870, 90614 Molecular Weight 21009.53 Da.
    Residues 178 Isoelectric Point 5.01
    Sequence mtktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivmltegiykisw teptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsrekyatypklvvpefanit ymgdagqnnedviseapykempndirngkyfdqnyhrlnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.212
    Matthews' coefficent 2.16 Rfactor 0.175
    Waters 296 Solvent Content 42.69

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gc9
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Overexpression, purification, crystallization and preliminary structural studies of p-coumaric acid decarboxylase from Lactobacillus plantarum
    H Rodrguez, B De Las Rivas, R Muoz - Section F: Structural , 2007 - scripts.iucr.org
     
    3. p_Coumaric acid decarboxylase from Lactobacillus plantarum: Structural insights into the active site and decarboxylation catalytic mechanism
    H Rodrguez, I Angulo, B de las Rivas - Proteins: Structure, , 2010 - Wiley Online Library
     
    4. Structural basis of enzymatic activity for the ferulic acid decarboxylase (FADase) from Enterobacter sp. Px6-4
    W Gu, J Yang, Z Lou, L Liang, Y Sun, J Huang, X Li - PloS one, 2011 - dx.plos.org
     
    5. Structural analysis of Bacillus pumilus phenolic acid decarboxylase, a lipocalin-fold enzyme
    A Matte, S Grosse, H Bergeron, K Abokitse - Section F: Structural , 2010 - scripts.iucr.org
     
    6. Mutational analysis of phenolic acid decarboxylase from Bacillus subtilis (BsPAD), which converts bio-derived phenolic acids to styrene derivatives
    A Frank, W Eborall, R Hyde, S Hart - Catalysis Science & , 2012 - pubs.rsc.org
     
    7. An endogenous factor enhances ferulic acid decarboxylation catalyzed by phenolic acid decarboxylase from Candida guilliermondii
    HK Huang, LF Chen, M Tokashiki, T Ozawa - AMB , 2012 - amb-express.com
     

    Protein Summary

    The lp_3665 gene from Lactobacillus plantarum encodes the NP_786857 protein, a putative phenolic acid decarboxylase (Pfam05870). Phenolic acids (ferulic, p-coumaric and caffeic acids) have protective role against oxidative damage diseases (coronary heart disease, stroke, and cancers) and are used in processed foods as a natural antioxidants. Vinyl phenol derivatives, created during decarboxylation of phenolic acids, were found to be much more inhibitory to the E. coli then these acids themself (PubMed:11229892).

    2gc9 structure has an up-and-down, ten stranded beta barrel fold. Most proteins with up-and-down beta barrel fold are integral transmembrane proteins. However, 2gc9 barrel has an elongated shape, which can be described as consisting of two sheets, while integral membrane beta barrel proteins are  much more symmetrical, almost round.

    A second protein from this family, ferulate decarboxylase from Bacillus subtilis, PDB code 2p8g was recently solved by JCSG.
     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch