.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gb4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Thiopurine methyltransferase (18204406) from Mus musculus at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 2gb4 Target Id 354534
    Molecular Characteristics
    Source Mus musculus
    Alias Ids TPS1334,18204406, 89641, 89682, 89713, 289628, 289423, 289446, 289625, 289339 Molecular Weight 27584.24 Da.
    Residues 240 Isoelectric Point 6.00
    Sequence msldmkehpdaevqknqvltledwkekwvtrhisfhqeqghqllkkhldtflkgqsglrvffplcgkai emkwfadrghtvvgveiseigireffaeqnlsyteeplaeiagakvfksssgsislyccsifdlprani gkfdriwdrgalvainpgdhdryadiilsllrkefqylvavlsydptkhagppfyvpsaelkrlfgtkc smqcleevdaleerhkawgldylfeklylltek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.25 Rfree 0.193
    Matthews' coefficent 2.43 Rfactor
    Waters 402 Solvent Content 48.98

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2gb4
    1. Structural Basis of Substrate Recognition in Thiopurine S-Methyltransferase
    Y Peng, Q Feng, D Wilk, AA Adjei - Biochemistry, 2008 - ACS Publications
     

    Protein Summary

    The gene 18204406 from Mus musculus (mouse) encodes the enzyme thiopurine S-methyltransferase (TPMT) EC:2.1.1.67 PF05724.  The enzyme catalyzes methylation of thiopurine compounds. The methyl is transferred from S-adenosyl-L-methionine, which is converted to S-adenosyl-L-homocysteine.  The protein contains the Rossman-fold NAD(P)-binding domain.  To date several crystal structures of the enzyme  and its homologues have been solved (PDB:3BGD3BGI, 2BZG).  The enzyme attracts significant attention because of its involvement in modulating cytotoxic effects of such prodrugs as 6-mercaptopurine.  6-mercaptopurine is a chemotherapeutic agent.   Patients with TPMT variant allozymes exhibit diminished levels of protein and/or enzyme activity and are at risk for thiopurine drug-induced toxicity [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch