.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g8l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (3258004) from Pyrococcus horikoshii at 2.04 A resolution. To be published
    Site JCSG
    PDB Id 2g8l Target Id 357888
    Molecular Characteristics
    Source Pyrococcus horikoshii ot3
    Alias Ids TPS1380,3258004, 289730, 89893 Molecular Weight 32553.35 Da.
    Residues 287 Isoelectric Point 5.62
    Sequence mkvqyecltcmanqcqrivematqdmdirrramilaakllakeynenaipaiagsliflelykflgndd pfieyklkseemarkvadiikrklkldfelavklaiignvidfsvgfspedleeevekmlkdklyidds kelfeevkraenilyitdnvgehyfdailiekireisnaevyiagkegpiindatvedlkragleklgk vistgtrivgvplklvsrefmeafnkadviiakgqgnfetlseindsriffllkakcpavarelkvpkg alvcmrnkfkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.04 Rfree 0.182
    Matthews' coefficent 2.73 Rfactor 0.144
    Waters 306 Solvent Content 54.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g8l
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The PH1575 gene from Pyrococcus horikoshii encodes a protein of unknown function from the DUF89 group (PF01937).  According to the SCOP classification, the 2g8l structure belongs to the class of multidomain proteins and reveals an AF1104-like fold type SCOP111320.  The structure of the homologous protein from Archaeoglobus fulgidus is available 2FFJ

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch