.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g80

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of UTR4 protein (Unknown transcript 4 protein) (yel038w) from Saccharomyces cerevisiae at 2.28 A resolution. To be published
    Site JCSG
    PDB Id 2g80 Target Id 354980
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS1344,YEL038W Molecular Weight 26734.02 Da.
    Residues 241 Isoelectric Point 6.09
    Sequence mvigqkvllaripkmgdnystylldiegtvcpisfvketlfpyftnkvpqlvqqdtrdspvsnilsqfh idnkeqlqahilelvakdvkdpilkqlqgyvwahgyesgqikapvyadaidfikrkkrvfiyssgsvka qkllfgyvqdpnapahdsldlnsyidgyfdintsgkktetqsyanilrdigakasevlflsdnplelda aagvgiatglasrpgnapvpdgqkyqvyknfetl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.28 Rfree 0.229
    Matthews' coefficent 2.60 Rfactor 0.177
    Waters 320 Solvent Content 52.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g80
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary

    The gene YEL038W from Saccharomyces cerevisiae encodes the enzyme enolase-phosphatase E1, alternative name of the enzyme is 2,3-diketo-5-methylthio-1-phosphopentane phosphatase.  Enolase-phosphatase E1 is a bifunctional enzyme in the ubiquitous methionine-salvage pathway and catalyzes the continuous reaction of 2,3- diketo-5-methylthio-1-phosphopentane to yield the acireductone metabolite.  The protein belongs to the class of alpha and beta proteins (a+b) and reveals a HAD-like fold SCOP56784 PF00702, containing 2 domains: (1) alpha/beta with a Rossmann-fold topology, (2) 4-helical bundle.

    The structure of the highly similar (1.74 Å rmsd, 32% identity) human enzyme has been reported [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch