.
The Open Protein Structure Annotation Network
PDB Keyword
.

2g40

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (6459694) from Deinococcus radiodurans at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2g40 Target Id 357226
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS1376,6459694, BIG_379, PF02589, 289799 Molecular Weight 22619.64 Da.
    Residues 212 Isoelectric Point 5.52
    Sequence mttipstaeaklemlttinraiagsrpealppypvpaplsraeilhqfedrildygaaythvsaaelpg aiakalgnarrvivpagipapwltvgmdvlrdepplshaeldradavltgcavaisetgtiildhradq grralslipdfhicvvredqivqtvregveavaasvregrpltwlsggsatsdielvrvegvhgprrlq vivvg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.22
    Matthews' coefficent 1.80 Rfactor 0.178
    Waters 132 Solvent Content 29.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2g40

    Protein Summary

    Gene DR_1909 from Deinococcus radiodurans encodes the NP_295632 protein that belongs to the DUF162 family (PF02589).

    2g40 shows a reasonably good structural alignment (3.2 Å over 87 residues, Z-score 3.4, 11% sequence id) with a transhydrogenase from Rhodospirillum rubrum (PDB id: 1u28). 2g40 shares some common features with the dIII and each of the two domains of the dI subunits of 1u28, such as a core parallel beta sheet flanked by alpha-helices on both sides, but a very different strand order and only partial topological similarity. 2g40 appears to be dimeric.

        

    To do: check whether NAD(P) can be docked onto 2g40. No visible GxGxxG motif.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch