.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fyx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a putative Transposase(6457846) from DEINOCOCCUS RADIODURANS at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2fyx Target Id 357203
    Molecular Characteristics
    Source Deinococcus radiodurans r1
    Alias Ids TPS1375,6457846, PF01797, 289629 Molecular Weight 15004.56 Da.
    Residues 131 Isoelectric Point 7.92
    Sequence mkkgrgyvykleyhliwatkyrhqvlvdevadglkdilrdiatqnglelvalevmpdyvhlllgatpqh vipdfvkalkgasarrmfsafphlkqphwggnlwnpsycvltvsehtraqiqqyienqhaae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.191
    Matthews' coefficent 3.27 Rfactor 0.16
    Waters 160 Solvent Content 62.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fyx
    1. DNA recognition and the precleavage state during single-stranded DNA transposition in D. radiodurans
    AB Hickman, JA James, O Barabas, C Pasternak - The EMBO , 2010 - nature.com
     

    Protein Summary

    The gene DR_0177 from Deinococcus radiodurans encodes the NP_293901 protein, a member of the IS200-like transposase group PF01797. Its genomic neighborhood shows the presence of an RNA polymerase sigma E factor (DR_0180) and a nucleoside triphosphatase (DR_0179).

    The 2fyx structure belongs to the class of alpha and beta (a+b) proteins and reveals ferredoxin-like fold type SCOP54861 inside the transposase IS200-like (super)family. The top hit in DALI is the transposase with PDB code 2ec2 (Z=17). Several structures of 2fyx homologues (33% seq. id.) have been solved: 2VHG, Helicobacter pylori (Z=15);  2A6MHelicobacter pylori (Z=16).

    Transposases are required for efficient transposition of the mobile DNA element.  

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch