.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ftz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Geranyltranstransferase (EC 2.5.1.10) (tm0161) from THERMOTOGA MARITIMA at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2ftz Target Id 282041
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1187,TM0161, 89978 Molecular Weight 31022.42 Da.
    Residues 272 Isoelectric Point 5.41
    Sequence mkkekveerireilrpgwdllteeamlysatvggkrirpllvltlgedlgveeeklldvavavelfhta slihddlppidnadfrrgkpschrtygediallagdglfflafsqiskignskifeefsetayklllge amdveferrkmevsqemvermyafktgalfafcfsapfilkgkdhtkmkllgekfgvafqiyddlkdil gsfekvgkdlgkdtekvtlvkkvgiqkaremadkyyeevlkgieseglfrtlfllkelkqmveer
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.203
    Matthews' coefficent 3.32 Rfactor 0.169
    Waters 171 Solvent Content 62.67

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ftz
    1. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     
    2. A novel predicting algorithm of thermostable proteins based on choquet integral with respect to L-measure and hurst exponent
    JI Shieh, YL Liu, KJ Lee, PC Chang - Machine Learning and , 2009 - ieeexplore.ieee.org
     
    3. STREPTAVIDIN MACROMOLECULAR ADAPTOR AND COMPLEXES THEREOF
    FR Salemme, PC Weber - US Patent App. 12/766,658, 2010 - Google Patents
     
    4. Transcriptional activity and regulation of sterol carrier protein-2 and sterol carrier protein-like genes in Aedes aegypti
    I Vyazunova - 2008 - books.google.com
     

    Protein Summary

    The TM0161 gene of Thermotoga maritima encodes a geranyltranstransferase (EC 1.5.1.10, PF00348, COG0142). The TM0161 structure is an all-alpha protein with a terpenoid synthase fold and is very similar (backbone rmsd of 1.7 Å over 254 residues with a sequence identity of 31%) to the geranyltranstransferase from Shigella flexneri (PDB id: 2for). The structural similarity also extends to orthologs from Agrobacterium tumefaciens (PDB id: 2h8o), Escherichia coli (PDB ids: 1rqj, 1rtr, 1rqi), and other hyperthermophiles such as Pyrococcus horikoshii (PDB id: 1wy0) and Thermus thermophilus (PDB id: 1wmw). More details on the structure and reaction mechanism can be found in Hosfield 2004, Kloer 2006, K-M Chen 2008.

     

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch