.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fea

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of MtnX phosphatase from Bacillus subtilis at 2.0 A resolution provides a structural basis for bipartite phosphomonoester hydrolysis of 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate. Proteins 69 433-439 2007
    Site JCSG
    PDB Id 2fea Target Id 359084
    Molecular Characteristics
    Source Bacillus subtilis subsp. subtilis str. 168
    Alias Ids TPS1415,2633731 Molecular Weight 27000.41 Da.
    Residues 235 Isoelectric Point 4.85
    Sequence mttrkpfiicdfdgtitmndniinimktfappewmalkdgvlsktlsikegvgrmfgllpsslkeeits fvledakiregfrefvafineheipfyvisggmdffvypllegivekdriycnhasfdndyihidwphs ckgtcsnqcgcckpsvihelsepnqyiimigdsvtdveaaklsdlcfardyllnecreqnlnhlpyqdf yeirkeienvkevqewlqnknagesslk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.217
    Matthews' coefficent 2.42 Rfactor 0.16
    Waters 365 Solvent Content 48.80

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fea
    1. Crystal structure of MtnX phosphatase from Bacillus subtilis at 2.0 resolution provides a structural basis for bipartite phosphomonoester hydrolysis of 2_hydroxy_3_
    Q Xu, KS Saikatendu, S Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary

    YkrX (MtnX) encodes 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase (EC 3.1.3.-) from methionine salvage pathway that produces 1,2-dihydroxy-3-keto-5-methylthiopentene.

    MtnX and MtnV are dispensable in methionine salvage pathway (PubMed:12022921). In B. subtilis mtnW (ykrW) encod enolase and mtnX (ykrX) encode phosphatase creating 1,2-dihydroxy-3-keto-5-methylthiopentene, while in other organisms, this step is performed by an enolase-phosphatase, encoded by gene mtnC, while mtnD (ykrZ) codes for the aci-reductone dioxygenase. (PubMed:15102328)

    YkrX (MtnX) has HAD-like fold (SCOP sunid:56783), with 3 layers (?/?/? parallel ?-sheet of 6 strands, order 321456). The structure of the family contains additional domain - inserted four helix bundle.


    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch