.
The Open Protein Structure Annotation Network
PDB Keyword
.

2fcl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (tm1012) from Thermotoga maritima at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 2fcl Target Id 282879
    Related PDB Ids 2ewr 
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1253,TM1012, 84734 Molecular Weight 18625.54 Da.
    Residues 158 Isoelectric Point 6.35
    Sequence mirpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqtdeegayeierifsefvskkvr fsstekicshfgeliidgikveimgdirkrledgtwedpvdlnkykrfvethgmkipvlsleyeyqayl klgrvekaetlrkwlnerkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.17
    Matthews' coefficent 2.18 Rfactor 0.14
    Waters 261 Solvent Content 43.55

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2fcl
    1. Functional annotation strategy for protein structures
    O Doppelt, F Moriaud, A Bornot, AG De Brevern - Bioinformation, 2007 - ncbi.nlm.nih.gov
     
    2. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     
    3. Dveloppement d'une nouvelle mthode performante de classification des surfaces protiques d'interaction. Optimisations et extensions du logiciel MED-SuMo.
    O Doppelt-Azeroual - 2009 - hal-univ-diderot.archives-ouvertes.fr
     
    4. A novel approach to studying the structural and functional properties of proteins with unknown functions
    MA Gorbacheva, AG Yarosh, PV Dorovatovskii - Russian Journal of , 2012 - Springer
     

    Protein Summary

    The TM1012 gene from  Thermotoga maritima encodes the NP_228818 protein from the DNA polymerase beta-like nucleotidyl-transferase superfamily (cd07749).  

    SCOP classifies 2fcl in the alpha+beta class, nucleotidyltransferase superfamily. The structure of the same protein has been deposited previously with access code 2EWR. DALI top but weak hits (Z=7) are with tRNA transferases like 3h37, 1miv and 2zh3. 

    TM1012 is a putative nucleotidyltransferase. All the RNA-directed RNA polymerases, and many DNA-directed polymerases, employ a fold whose organisation has been likened to the shape of a right hand with three subdomains termed fingers, palm and thumb [Ref] . Only the palm subdomain, composed of a four-stranded antiparallel beta-sheet with two alpha-helices, is well conserved among all of these enzymes.   

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch