.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f8l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (16411011) from Listeria monocytogenes LI2 at 2.20 A resolution. To be published
    Site JCSG
    PDB Id 2f8l Target Id 359352
    Molecular Characteristics
    Source Listeria monocytogenes egd-e
    Alias Ids TPS1422,16411011, 432863 Molecular Weight 37216.79 Da.
    Residues 332 Isoelectric Point 4.89
    Sequence maneatqelfqvldntaiilqneleisyleavyetgenlfqkevlqkeelssekqlklqesyesielen fsneeirkglqlallkgmkhgiqvnhqmtpdsigfivayllekviqkkknisildpacgtanllttvin qlelkgdvdvhasgvdvddllislalvgadlqrqkmtllhqdglanllvdpvdvvisdlpvgyypdden aktfelcreeghsfahflfieqgmrytkpggylfflvpdamfgtsdfakvdkfikknghiegiiklpet lfkseqarksililrkadvnvkppkevllanlssltdpsvtapilaeienwfkskq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.211
    Matthews' coefficent 3.75 Rfactor 0.165
    Waters 154 Solvent Content 66.92

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f8l
    1. MarkUs: a server to navigate sequencestructurefunction space
    M Fischer, QC Zhang, F Dey, BY Chen - Nucleic Acids , 2011 - Oxford Univ Press
     

    Protein Summary

    The gene lmo1582 from Listeria monocytogenes encodes the NP_465107 protein, a putative S-adenosylmethionine-dependent methyltransferase (SAM or AdoMet-MTase) class I, a member of N-6 DNA methylase-like family PF02384. The enzyme belongs to the class of alpha and beta (a+b) proteins and reveals S-adenosyl-L-methionine-dependent methyltransferases fold type SCOP53334.  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.). 

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch