.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f4i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (tm0957) from THERMOTOGA MARITIMA at 2.25 A resolution. To be published
    Site JCSG
    PDB Id 2f4i Target Id 358444
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1391,TM0957 Molecular Weight 21007.09 Da.
    Residues 185 Isoelectric Point 4.92
    Sequence eemekgfdpkryarelwfklqdmmneglgydavevlntldenpelahqkfakvvgvsnyryyiiqgvge iveikddgilvkvrenrkvpdlflsnhifgngivnatgiakmedfdriidfnltatelnkivkeevvns flkqlskgagsvgslvrfiavftllkdeeikypieaiplyleiqggf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.25 Rfree 0.248
    Matthews' coefficent 2.41 Rfactor 0.19
    Waters 484 Solvent Content 48.61

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2f4i
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     
    4. Structure and ligand binding of the soluble domain of a Thermotoga maritima membrane protein of unknown function TM1634
    CJ McCleverty, L Columbus, A Kreusch - Protein , 2008 - Wiley Online Library
     

    Protein Summary

    The gene TM0957 from Thermotoga maritima encodes the NP_228765 protein, a predicted periplasmic lipoprotein from the DUF2291 group (PF10054).  

    A fold type search indicates that the 2f4i structure belongs to the OB (oligonucleotide/oligosaccharide binding)-fold (SCOP50198 ). DALI weak top hit is with the putative nucleic acid binding lipoprotein 3f1z (Z=7).

    The OB-fold domains have been observed in four different proteins which bind oligonucleotides or oligosaccharides: nuclease, anticodon binding domain of Asp-tRNA synthetase and B-subunits of heat-labile enterotoxin and verotoxin-1 [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch