.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ewr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein (tm1012) from Thermotoga maritima at 1.60 A resolution. To be published
    Site JCSG
    PDB Id 2ewr Target Id 282879
    Related PDB Ids 2fcl 
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1912,TM1012, 84734 Molecular Weight 18625.54 Da.
    Residues 158 Isoelectric Point 6.35
    Sequence mirpeylrvlrkiydrlknekvnwvvtgslsfalqgvpvevhdidiqtdeegayeierifsefvskkvr fsstekicshfgeliidgikveimgdirkrledgtwedpvdlnkykrfvethgmkipvlsleyeyqayl klgrvekaetlrkwlnerkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.18
    Matthews' coefficent 2.16 Rfactor 0.145
    Waters 220 Solvent Content 42.99

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2ewr
    1. Prediction of functional sites based on the fuzzy oil drop model
    M Bryli_ski, K Prymula, W Jurkowski - PLoS computational , 2007 - dx.plos.org
     
    2. Functional annotation strategy for protein structures
    O Doppelt, F Moriaud, A Bornot, AG De Brevern - Bioinformation, 2007 - ncbi.nlm.nih.gov
     
    3. Comprehensive classification of nucleotidyltransferase fold proteins: identification of novel families and their representatives in human
    K Kuchta, L Knizewski, LS Wyrwicz - Nucleic acids , 2009 - Oxford Univ Press
     
    4. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     
    5. Dveloppement d'une nouvelle mthode performante de classification des surfaces protiques d'interaction. Optimisations et extensions du logiciel MED-SuMo.
    O Doppelt-Azeroual - 2009 - hal-univ-diderot.archives-ouvertes.fr
     

    Protein Summary

    Thermotoga maritima TM1012 gene encodes the protein NP_228818 belonging to the nucleotidyl transferase from a DNA polymerase beta-like superfamily (cd07749), with strong structural (FATCAT RMSD of 2.94A on 124 positions; Dali Zscr=7) and weak, but statistically significant sequence similarity (FFAS Z-score of -13.9) to N-terminal domain of tRNA nucleotidyltransferase (PDB:1r8c). Other DALI hits at Z=7 include nucleotidyl transferases 3h39, 2dr8 and 1miv. SCOP classifies 2ewr in the alpha+beta class, nucleotidyl-transferase superfamily, TM1012-like family.

    Warning - TM1012 appears to have spurious FFAS matches to other proteins, such as nucleotidyltransferase 1wot, cystidine-deaminase-like fold protein TM1506 (1vk9) or four-helical bundle protein 2huj. These proteins are not structurally similar to TM1012!

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    2fcl.png
    No description
    28.25 kB20:09, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch