The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Ribonuclease HII (EC (RNase HII) (tm0915) from THERMOTOGA MARITIMA at 1.74 A resolution. To be published
    Site JCSG
    PDB Id 2etj Target Id 282784
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1244,TM0915 Molecular Weight 26628.53 Da.
    Residues 238 Isoelectric Point 8.43
    Sequence mgidelykkefgivagvdeagrgclagpvvaaavvlekeiegindskqlspakrerlldeimekaavgi giaspeeidlynifnatklamnralenlsvkpsfvlvdgkgielsvpgtclvkgdqkskligaasivak vfrdrlmsefhrmypqfsfhkhkgyatkehlneirkngvlpihrlsfepvlelltddllreffekglis enrferilnllgarksvvfrkertnhnlplf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.74 Rfree 0.219
    Matthews' coefficent 2.08 Rfactor 0.179
    Waters 161 Solvent Content 40.89

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 2etj
    1. Ribonuclease H: molecular diversities, substrate binding domains, and catalytic mechanism of the prokaryotic enzymes
    T Tadokoro, S Kanaya - Febs Journal, 2009 - Wiley Online Library
    2. Crystal structures of RNase H2 in complex with nucleic acid reveal the mechanism of RNA-DNA junction recognition and cleavage
    MP Rychlik, H Chon, SM Cerritelli, P Klimek, RJ Crouch - Molecular cell, 2010 - Elsevier
    3. Identification of RNase HII from psychrotrophic bacterium, Shewanella sp. SIB1 as a high_activity type RNase H
    H Chon, T Tadokoro, N Ohtani, Y Koga - FEBS , 2006 - Wiley Online Library
    4. Evolution and thermodynamics of the slow unfolding of hyperstable monomeric proteins
    J Okada, T Okamoto, A Mukaiyama - BMC evolutionary , 2010 - biomedcentral.com
    5. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
    6. Effect of the termini of RNase Hs from Chlamydophila pneumoniae on enzymatic biochemical characterization
    J Hou, Z Lu, X Guo, J Liu - Acta Biochimica et Biophysica , 2012 - abbs.oxfordjournals.org

    Protein Summary

    The gene TM0915 from Thermotoga maritima encodes ribonuclease H type II EC: (ribonucleases H type II superfamily PF01351 COG0164).  Ribonuclease HII is involved in the degradation of the ribonucleotide moiety on RNA-DNA hybrid molecules carrying out endonucleolytic cleavage to 5'-phospo-monoester. Proteins which belong to this family have been found in bacteria, archaea, and yeasts. This family also includes Ribonuclease HIII.

    Ligand Summary





    No references found.

    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch