.
The Open Protein Structure Annotation Network
PDB Keyword
.

2eth

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Transcriptional regulator, putative, MAR family (tm0816) from Thermotoga maritima at 2.50 A resolution. To be published
    Site JCSG
    PDB Id 2eth Target Id 282686
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1237,TM0816, 85023 Molecular Weight 16386.06 Da.
    Residues 142 Isoelectric Point 5.22
    Sequence mdaleifktlfslvmrfssylpsneeisdmkttelyaflyvalfgpkkmkeiaeflsttksnvtnvvds lekrglvvremdpvdrrtyrvvltekgkeifgeilsnfesllksvlekfseedfkvvsegfnrmveals regr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.264
    Matthews' coefficent 2.65 Rfactor 0.227
    Waters 47 Solvent Content 53.27

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2eth
    1. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    2. Rapid Assay Development and Refinement for Targeted Protein Quantitation Using an Intelligent SRM (iSRM) Workflow
    R Kiyonami, A Schoen, A Prakash, H Nguyen - 2009 - thermoinformatics.com
     
    3. PHARMACOPROTEOMIC ANALYSIS OF THREE DIFFERENT CHONDROITIN SULFATE COMPOUNDS IN HUMAN CHONDROCYTES CULTURES
    I SITES - IEEE/ACM Trans Comput Biol Bioinform, 2011 - eupa.org
     
    4. P1 Endemic mycoses
    C Nationale, L Chemicals - 2012 - Wiley Online Library
     

    Protein Summary

    TM0816 gene from Thermotoga maritima encodes the NP_228625 protein, a putative transcriptional regulator from the MarR family (Pfam01047). TM0816 is involved in heat-shock response ([Ref]), where induction of this marR homolog plus several other putative transcriptional regulators (TM1023, TM1069), and two alpha-glucosidases (TM0434 and TM1068), indicate late heat-shock responses.

    The 2eth structure belongs to the SCOP all alpha class, winged-helix DNA binding domain superfamily, MarR-like transcriptional regulator family. A DALI search returns hits with the transcriptional regulator 1nyx (Z=13), the YUSO protein 1s3j (Z=13), the putativre MarR factor 2rdp (Z=13), and TM0710 2a61 (Z=13).



     

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch