.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b8n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of a glycerate kinase (TM1585) from Thermotoga maritima at 2.70 A resolution reveals a new fold. Proteins 65 243-248 2006
    Site JCSG
    PDB Id 2b8n Target Id 283442
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1301,TM1585, 282188 Molecular Weight 44719.92 Da.
    Residues 417 Isoelectric Point 5.73
    Sequence mfdpeslkklaieivkksieavfpdravketlpklnldrvilvavgkaawrmakaayevlgkkirkgvv vtkyghsegpiddfeiyeaghpvpdentikttrrvlelvdqlnendtvlfllsgggsslfelplegvsl eeiqkltsallksgasieeintvrkhlsqvkggrfaervfpakvvalvlsdvlgdrldviasgpawpds stsedalkvlekygietsesvkrailqetpkhlsnveihlignvqkvcdeakslakekgfnaeiittsl dceareagrfiasimkevkfkdrplkkpaalifggetvvhvkgngiggrnqelalsaaialegiegvil csagtdgtdgptdaaggivdgstaktlkamgedpyqylknndsynalkksgallitgptgtnvndliigliv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.53 Rfree 0.246
    Matthews' coefficent 2.60 Rfactor 0.182
    Waters 97 Solvent Content 52.38

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b8n
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Glycerate 2-kinase of Thermotoga maritima and genomic reconstruction of related metabolic pathways
    C Yang, DA Rodionov, IA Rodionova, X Li - Journal of , 2008 - Am Soc Microbiol
     
    3. Purification and characterization of glycerate kinase from the thermoacidophilic archaeon Thermoplasma acidophilum: an enzyme belonging to the second glycerate
    M Noh, JH Jung, SB Lee - Biotechnology and Bioprocess Engineering, 2006 - Springer
     
    4. Crystal structure of a glycerate kinase (TM1585) from Thermotoga maritima at 2.70 resolution reveals a new fold
    R Schwarzenbacher, D McMullan - Proteins: Structure, , 2006 - Wiley Online Library
     
    5. A unique highly thermostable 2-phosphoglycerate forming glycerate kinase from the hyperthermophilic archaeon Pyrococcus horikoshii: gene cloning, expression and
    B Liu, Y Hong, L Wu, Z Li, J Ni, D Sheng, Y Shen - Extremophiles, 2007 - Springer
     
    6. Re-Annotation of Two Hyperthermophilic Archaea Pyrococcus abyssi GE5 and Pyrococcus furiosus DSM 3638
    J Gao, J Wang - Current microbiology, 2012 - Springer
     

    Protein Summary

    2b8n replaced 1o0u.

    The TM1585 gene of Thermotoga maritima encodes glycerate kinase (EC: 2.7.1.31; COG2379). Distant homolog of TM1585 from the grapevine pathogen Agrobacterium vitis was shown to degrade an unidentified toxic product from the first step of tartrate degradation (PubMed:8672817).

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (1)

    FileSizeDateAttached by 
    1o0u.jpg
    No description
    19.85 kB20:09, 30 Jun 2008dweekesActions
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch