.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b8m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (1499583) from METHANOCOCCUS JANNASCHII at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2b8m Target Id 359364
    Molecular Characteristics
    Source Methanocaldococcus jannaschii dsm 2661
    Alias Ids TPS1423,1499583, 2.60.120.10, 87276 Molecular Weight 13567.17 Da.
    Residues 116 Isoelectric Point 6.59
    Sequence miekvyefkrdaktkvveklvntehvqinhivlprgeqmpkhysnsyvhliiikgemtltledqephny kegnivyvpfnvkmliqninsdileffvvkaphpkklnapedpikce
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.204
    Matthews' coefficent 1.91 Rfactor 0.149
    Waters 132 Solvent Content 39.70

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b8m
    1. Automatic procedure for using models of proteins in molecular replacement
    D Raimondo, A Giorgetti, S Bosi - PROTEINS: Structure, , 2007 - Wiley Online Library
     

    Protein Summary

    The gene MJ0764 from Methanococcus jannaschii encodes the NP_247749 protein containing a domain from the cupin superfamily PF07883.  The 2b8m structure belongs to the class of all beta proteins and reveals a double-stranded beta-helix (beta-barrel) fold type, inside the RmlC-like cupins superfamily, MJ0764-like family SCOP51181. DALI top hits are with the proteins SPY1581 PDB:1yhf (Z=13),  TTHA0104 PDB:2dct(Z=13) and the cupin PDB:3fjs (Z=13). 

    The cupin superfamily of proteins is among the most functionally diverse of any described to date. It was named on the basis of the conserved β-barrel fold (‘cupa’ is the Latin term for a small barrel). The family comprises both enzymatic and non-enzymatic members, which have either one or two cupin domains. Within the conserved tertiary structure, the variety of biochemical function is provided by minor variation of the residues in the active site, and the identity of the bound metal ion [Ref].

    Ligand Summary

     

    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch