.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b4a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of BH3024 protein (10175646) from BACILLUS HALODURANS at 2.42 A resolution. To be published
    Site JCSG
    PDB Id 2b4a Target Id 358875
    Molecular Characteristics
    Source Bacillus halodurans c-125
    Alias Ids TPS1407,10175646, 342259 Molecular Weight 14141.40 Da.
    Residues 126 Isoelectric Point 5.52
    Sequence mqpfrvtlvedepshatliqyhlnqlgaevtvhpsgsaffqhrsqlstcdllivsdqlvdlsifslldi vkeqtkqpsvlilttgrheliessehnlsylqkpfaiselraaidyhkpsmgvtmnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.42 Rfree 0.243
    Matthews' coefficent 2.54 Rfactor 0.182
    Waters 25 Solvent Content 51.29

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2b4a
    1. Receiver domain structure and function in response regulator proteins
    RB Bourret - Current opinion in microbiology, 2010 - Elsevier
     
    2. The JCSG MR pipeline: optimized alignments, multiple models and parallel searches
    R Schwarzenbacher, A Godzik - Section D: Biological , 2007 - scripts.iucr.org
     
    3. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     

    Protein Summary

    The gene BH3024 from Bacillus halodurans encodes a response regulator receiver domain (REC), a member of CheY clan ( PF00072).  

    2b4a structure belongs to the class of alpha and beta (a+b) proteins and adopts a flavodoxin-like fold type,  CheY-like (super)family SCOP52171. DALI top hits (Z=16) are with the response regulator PDB:3gl9, the sensor protein PDB:3dge, the sporulation initiator phosphotransferase-F PDB:1pey, and the REC domain containing Che-Y like protein PDB:3i42.

    The REC domain receives the signal from the sensor partner in a two-component systems.  The domain contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs.  Within the genomic context, it is usually found N-terminal to a DNA binding effector domain.  Its biological unit is a homodimer.  CheY-like phosphoacceptor REC domain is a common module in a variety of response regulators of the bacterial signal transduction systems.  To date, 4,610 response regulators, encoded in complete genomes of 200 bacterial and archaeal species, have been identified [Ref].

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch