.
The Open Protein Structure Annotation Network
PDB Keyword
.

2anu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Predicted metal-dependent phosphoesterase (PHP family) (tm0559) from THERMOTOGA MARITIMA at 2.40 A resolution. To be published
    Site JCSG
    PDB Id 2anu Target Id 282432
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1214,TM0559, 84920 Molecular Weight 28611.07 Da.
    Residues 243 Isoelectric Point 5.61
    Sequence mktdtewllcdfhvhtnmsdghlplgevvdlfgkhgvdvvsitdhivdrrtleqrkrngeplgaitedk fqdylkrlwreqkraweeygmilipgveitnntdlyhivavdvkeyvdpslpveeiveklkeqnalvia ahpdrkkqdeehlswylwanmerfkdtfdaweianrddlfnsvgvkkyryvansdfhelwhvyswktlv kseknieaikeairkntdvaiylmrknrlsslsdvi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.40 Rfree 0.22
    Matthews' coefficent 2.92 Rfactor 0.169
    Waters 212 Solvent Content 57.54

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2anu
    1. Formation of tight junction: determinants of homophilic interaction between classic claudins
    J Piontek, L Winkler, H Wolburg, SL Mller, N Zuleger - The FASEB Journal, 2008 - FASEB
     
    2. The Structure of T. aquaticus DNA Polymerase III Is Distinct from Eukaryotic Replicative DNA Polymerases
    S Bailey, RA Wing, TA Steitz - Cell, 2006 - Elsevier
     
    3. Research Non-homologous isofunctional enzymes: A systematic analysis of alternative solutions in enzyme evolution
    MV Omelchenko, MY Galperin, YI Wolf, EV Koonin - 2010 - biomedcentral.com
     
    4. Crystal structure of monofunctional histidinol phosphate phosphatase from Thermus thermophilus HB8
    R Omi, M Goto, I Miyahara, M Manzoku, A Ebihara - Biochemistry, 2007 - ACS Publications
     
    5. Crystal structure of a metal_dependent phosphoesterase (YP_910028. 1) from Bifidobacterium adolescentis: Computational prediction and experimental validation of
    GW Han, J Ko, CL Farr, MC Deller, Q Xu - Proteins: Structure, , 2011 - Wiley Online Library
     

    Protein Summary


    The TM0559 gene from Thermotoga maritima encodes a putative meta-dependent phosphoesterase domain, a member of the PHP (Polymerase and Histidinol Phosphatase EC:3.1.3.15) superfamily PF02811 COG0613.  The PHP phosphatase domain is contained within the alpha subunits of bacterial DNA polymerase III and two distinct family X DNA polymerases [Ref].  The conserved motifs required for phospho-esterase activity are intact in the archaeal DNA polymerase subunits, but are disrupted in their eukaryotic orthologs. A hypothesis is proposed that bacterial and archaeal replicative DNA polymerases possess intrinsic phosphatase activity that hydrolyzes the pyrophosphate released during nucleotide polymerization.  The pyrophosphate hydrolysis may be necessary to drive the polymerization reaction forward.

     
     
     
     

     

     
     
     

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch