.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aj6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of hypothetical protein MW0638 from Staphylococcus aureus MW2 at 1.63 A resolution. To be published
    Site JCSG
    PDB Id 2aj6 Target Id 358652
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mw2
    Alias Ids TPS1399,NP_645455.1, 90030 Molecular Weight 17319.23 Da.
    Residues 147 Isoelectric Point 8.98
    Sequence mrtlnkdehnyikqianihetllsqvesnykctklsialryemicsrlehtndkiyiyenegqliafiw ghfsneksmvniellyvepqfrklgiatqlkialekwaktmnakrisntihknnlpmislnkdlgyqvs hvkmykdid
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.63 Rfree 0.217
    Matthews' coefficent 1.80 Rfactor 0.181
    Waters 122 Solvent Content 41.15

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2aj6

    Protein Summary

    The gene MW0638 from Staphylococcus aureus encodes the NP_645455 protein containing GCN5-related N-acetyltransferase (GNAT) domain (PF00583).

    SCOP classifies 2aj6 in the alpha+beta class, N-acetyl transferase family. DALI top hits are with the N-acetyl transferases PDB:2vbq (Z=14), PDB:1s3z and PDB:1eui (Z=13).

    The enzyme represents a large superfamily of functionally diverse enzymes that catalyze the transfer of an acetyl group from acetyl-Coenzyme A to the primary amine of a wide range of acceptor substrates.  Members of this superfamily include aminoglycoside N-acetyltransferases, serotonin N-acetyltransferase, glucosamine-6-phosphate N-acetyltransferase, the histone acetyltransferases, mycothiol synthase, and the Fem family of amino acyl transferases.  The inspection of the available structures of the enzyme homologues  in the PDB database indicates that the tandem GNAT protein from the clavulanic acid biosynthesis pathway from Streptomyces clavuligerus could be the closest functional homologue of the full length protein, containing this C-terminal domain PDB:2wpw (Z=11).  The N-terminal GNAT domain plays a structural role whereas the C-terminal domain is more likely to be directly involved in acetyl transfer [Ref].  Curiously, (3R,5R)-clavulanic acid is a clinically important inhibitor of Class A b-lactamases.  Clavulanic acid cannot be produced efficiently by chemical synthesis, hence it is produced by fermentation of Streptomyces clavuligerus.

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch