The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of 2-keto-3-deoxygluconate kinase (TM0067) from Thermotoga maritima at 2.05 A resolution. Proteins 70 603-608 2007
    Site JCSG
    PDB Id 2afb Target Id 281948
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1181,TM0067, 3.40.1190.20, 83936 Molecular Weight 37598.92 Da.
    Residues 339 Isoelectric Point 5.89
    Sequence mkvvtfgeimlrlsppdhkrifqtdsfdvtyggaeanvaaflaqmgldayfvtklpnnplgdaaaghlr kfgvktdyiarggnrigiyfleigasqrpskvvydrahsaiseakredfdwekildgarwfhfsgitpp lgkelpliledalkvanekgvtvscdlnyrarlwtkeeaqkvmipfmeyvdvlianeediekvlgisve gldlktgklnreayakiaeevtrkynfktvgitlresisatvnywsvmvfengqphfsnryeihivdrv gagdsfagaliygslmgfdsqkkaefaaaasclkhtipgdfvvlsieeieklasgatsgrver
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.23
    Matthews' coefficent 2.41 Rfactor 0.176
    Waters 394 Solvent Content 48.49

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information


    Google Scholar output for 2afb
    1. Toward the estimation of the absolute quality of individual protein structure models
    P Benkert, M Biasini, T Schwede - Bioinformatics, 2011 - Oxford Univ Press
    2. Crystal structure of 2_keto_3_deoxygluconate kinase (TM0067) from Thermotoga maritima at 2.05 resolution
    II Mathews, D McMullan, MD Miller - Proteins: Structure, , 2008 - Wiley Online Library
    3. Applications of Bioinformatics to Protein Structures: How Protein Structure and Bioinformatics Overlap
    GW Han, C Rife, MR Sawaya - Methods in Molecular Biology, 2009 - Springer

    Protein Summary

    The TM0067 gene (PF00294 , cd01166, cl00192) from Thermotoga maritima MSB8 encodes for a 2-dehydro-3-deoxygluconokinase (EC: [Ref], a carbohydrate kinase. The protein adopts a three layer alpha/beta/alpha sandwich structure and belongs to the ribokinase-like folds (2afb-SCOP, 2afb-CATH). Similar structures determined by the PSI are 2r3b, 1kyh, and possibly 1vl8.

    This entry supersedes 1j5v.

    Ligand Summary





    1. (No Results)


      Discuss this publication
    Tag page

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch