.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a6c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (np_841403.1) from NITROSOMONAS EUROPAEA at 1.90 A resolution. To be published
    Site JCSG
    PDB Id 2a6c Target Id 358727
    Molecular Characteristics
    Source Nitrosomonas europaea atcc 19718
    Alias Ids TPS1402,NP_841403.1, 342266 Molecular Weight 7938.99 Da.
    Residues 71 Isoelectric Point 8.16
    Sequence mkmrsqllivlqehlrnsgltqfkaaellgvtqprvsdlmrgkidlfsleslidmitsiglkveinikd aa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.241
    Matthews' coefficent 2.30 Rfactor 0.182
    Waters 72 Solvent Content 46.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a6c

    Protein Summary

    The gene NE1354 from Nitrosomonas europaea encodes the NP_841403.1 protein, a putative XRE-family transcription regulator (based on 52% sequence identity with XRE regulator from Burkholderia ambifaria MEX-5), and a member of DNA-binding domain Helix-Turn-Helix (HTH) superfamily PF01381.  The protein belongs to the class of all alpha proteins and adopts a lambda repressor-like DNA-binding domain fold type SCOP47412.  Prokaryotic XRE-family DNA binding proteins are the xenobiotic response element family of transcriptional regulators.  The structure of similar proteins from other organisms has been solved, including: 3F6W (Dali Zscr=6.5), from Pseudomonas syringae; 2O38 (Dali Zscr=12), from Rhodopseudomonas palustris; and 1Y7Y (Dali Zscr=6), from Aeromonas hydrophila.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch