.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a6b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (np_358222.1) from STREPTOCOCCUS PNEUMONIAE R6 at 1.70 A resolution. To be published
    Site JCSG
    PDB Id 2a6b Target Id 358745
    Molecular Characteristics
    Source Streptococcus pneumoniae r6
    Alias Ids TPS1403,NP_358222.1, _0115.002678_, 90069 Molecular Weight 25613.81 Da.
    Residues 222 Isoelectric Point 4.78
    Sequence metqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdaflsmlgacv ahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkafqdlmysavassdyahl lvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvqflvdelnrvgknredltelqqrwnq avalelaffdigydv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.175
    Matthews' coefficent 3.00 Rfactor 0.155
    Waters 240 Solvent Content 58.65

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a6b
    1. EM-Fold: De Novo Atomic-Detail Protein Structure Determination from Medium-Resolution Density Maps
    S Lindert, N Alexander, N Wtzel, M Karaka_ - Structure, 2012 - Elsevier
     
    2. CRYO-EM GUIDED DE NOVO PROTEIN FOLDING
    S Lindert - 2011 - etd.library.vanderbilt.edu
     

    Protein Summary

    The gene spr0628 from Streptococcus pneumoniae encodes the protein NP_358222, a putative transcriptional regulator from the TENA group (PF03070). Its genome context analysis indicates a functional link (score 0.83) with the transcriptional regulator tenA (spr0634).

    The same structure has been determined by the Midwest Center for Structural Genomics (PDB:1z72).  The 2a6b structure belongs to the class of all alpha proteins, heme oxygenase-like fold, heme oxygenase-like superfamily, TENA/THI-4 family SCOP48612. 2a6b Dali top hits with Z-scr=27 are with TENA/THI transcriptional activator structures like PDB:1yak, PDB:1to9, PDB:1tyh.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch