.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a3n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of Putative glucosamine-fructose-6-phosphate aminotransferase (16423107) from SALMONELLA TYPHIMURIUM LT2 at 1.35 A resolution. To be published
    Site JCSG
    PDB Id 2a3n Target Id 358650
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS1398,16423107, 3.40.50.10490, 432394 Molecular Weight 39217.85 Da.
    Residues 343 Isoelectric Point 5.75
    Sequence mnnqeknmlgfnqdeyltsareiiaarqkaeqvadeiyqagfsslffasvggslapmmainefakeltt lpvyveqaaelihkgnkrlnkdsvvitlsksgdtkesvaiaewckaqgirvvaitknadsplaqaatwh ipmrhkngveyeymllywlffrvlsrnnefasydrfasqleilpanllkakqkfdpqadaiasryhnsd ymmwvggaemwgevylfsmcileemqwkrtrpvssaeffhgalellekdvplilvkgegkcralderve rfaskitdnlvvidpkayaldgiddefrwimapcvvstllvdrlaahfekytghsldirryyrqfdy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.23 Rfree 0.14
    Matthews' coefficent 1.83 Rfactor 0.112
    Waters 481 Solvent Content 32.40

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a3n
    1. Decision-making in structure solution using Bayesian estimates of map quality: the PHENIX AutoSol wizard
    TC Terwilliger, PD Adams, RJ Read - Section D: Biological , 2009 - scripts.iucr.org
     
    2. Probing the active site of the sugar isomerase domain from E. coli arabinose_5_phosphate isomerase via X_ray crystallography
    LJ Gourlay, S Sommaruga, M Nardini - Protein , 2010 - Wiley Online Library
     

    Protein Summary

    The gene STM4540.S from Salmonella typhimurium lt2 encodes the NP_463399 protein, a glucosamine-fructose-6-phosphate aminotransferase (EC2.6.1.16) from the family of the class II aminotransferases, a superfamily of sugar isomerases containing a SIS domain (PF01380). The other names of this enzyme are glutamine-fructose-6-phosphate transaminase, D-fructose-6-phosphate amidotransferase, or GlcN6P synthase.  

    The 2a3n structure belongs to the class of alpha and beta proteins (a+b) and reveals a SIS domain fold type SCOP53696.  According to DALI, similar structures to 2a3n are: the Yurp protein PDB:3eua (Z=40), the putative isomerase PDB:3fkj (Z=38, topsan-3fkj), the crystal structure of the human homologue PDB:2zj3 (Z=33) and PDB:2v4m (Z=32).

    The enzyme is widely distributed in nature.  The enzyme catalyzes the reaction involving ammonia transfer and sugar phosphate isomerization:

    L-glutamine + D-fructose 6-phosphate -> D-glucosamine 6-phosphat + L-glutamate.

    The reaction mechanism involves the formation of ketimine between fructose 6-phosphate and a 6-amino group from a conserved lysine residue at the active site. This reaction is the first committed step of the cytoplasmic biosynthetic pathway leading to the formation of uridine 5'-diphospho-N-acetylglu-cosamine (UDP-GlcNAc). The final product of this pathway is an activated precursor of numerous macromolecules containing amino sugars, including chitin and mannoproteins in fungi, peptidoglycan and lipopolysaccharides in bacteria, and glycoproteins in mammals [Ref]

    Ligand Summary



    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch