.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a2o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (np_812058.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.16 A resolution. To be published
    Site JCSG
    PDB Id 2a2o Target Id 358760
    Related PDB Ids 2a2m 
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS1404,NP_812058.1, 282926 Molecular Weight 28144.14 Da.
    Residues 246 Isoelectric Point 4.86
    Sequence mndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlreasglipgtdi kdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwiewnggtpngayqmgnmle qyrdkidedkaveifntamnyelkvftsstilttiengk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 7
    Resolution (Å) 2.16 Rfree 0.173
    Matthews' coefficent 4.08 Rfactor 0.145
    Waters 1715 Solvent Content 69.64

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a2o
    1. Kinetic modelling in systems biology
    O Demin, I Goryanin - 2009 - books.google.com
     

    Protein Summary

    The gene BT_3146 from Bacteroides thetaiotaomicron encodes the NP_812058 protein, a putative transcriptional activator TenA homologue (PF03070).

    SCOP classifies 2a2o in the all alpha class, heme oxygenase-like superfamily, TenA/THI-4 family. Using 2a2o as query, Dali top hits are with TenA proteins like 2gm8 and 1udd (Z=24). 2a2o is very similar structurally to the homologous protein from Pyrococcus horikoshii 2RD3 (Dali Zscr=24).  The latter protein, in turn, is homologous to the Bacillus subtilis TenA-homologue protein PH1161.  

    TenA is known to belong to a family of transcription activators that stimulate the production of extracellular proteases in B. subtilis [Ref].

    Ligand Summary


    References

    Reviews

    References

     

    1. (No Results)

       


      Discuss this publication
    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch