.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a2m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Title Crystal structure of (np_812058.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.88 A resolution. To be published
    Site JCSG
    PDB Id 2a2m Target Id 358760
    Related PDB Ids 2a2o 
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi-5482
    Alias Ids TPS1920,NP_812058.1, 282926 Molecular Weight 28144.14 Da.
    Residues 246 Isoelectric Point 4.86
    Sequence mndfknqwlrkrtfaipasrltgrlttlksdvpaadslfwklwngsldtavqvlqtdyfkgiaagtldp naygslmvqdgyycfrgrddyataatcaqdetlreffkakaksydeynetyhqtwhlreasglipgtdi kdyadyeayvagslaspymcvvmlpceylwpwianfldgytptnslyrfwiewnggtpngayqmgnmle qyrdkidedkaveifntamnyelkvftsstilttiengk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.165
    Matthews' coefficent 3.77 Rfactor 0.142
    Waters 610 Solvent Content 67.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 2a2m
    1. In: Methods in Protein Structure and Stability Analysis ISBN 1-60021-704-4 Editors: V. Uversky and E. Permyakov, pp. 229-260 2007 Nova Science Publishers, Inc.
    C Ebel - Methods in protein structure and stability analysis: , 2007 - books.google.com
     

    Protein Summary

    The BT_3146 (NP_812058) gene from Bacteroides thetaiotaomicron descr encodes a protein (Q8A309) that belongs to a family of putative transcription activator TenA (COG0819) or TENA/THI-4/PQQC family (PF03070).

    In the crystal, 2a2m forms an hexamer of three loosely associated dimers. This is supported by size exclusion chromatography with static light scattering.

    It is structurally similar to proteins from SCOP family: TENA/THI-4 sunid:101458 such as:  PDB:1uddpdb:2gm7pdb:1rtw and pdb:1yaf.

    The same protein was independently solved at 1.88 A resolution and deposited in PDB as pdb:2a2o.

    Ligand Summary



    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch