.
The Open Protein Structure Annotation Network
PDB Keyword
.

283621

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 283621
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2358,TM1767 Molecular Weight 29555.70 Da.
    Residues 271 Isoelectric Point 6.86
    Sequence mwidcktiarsieertkerveklgftpklvsvactddpsalsylksqrkkaeklgiafeimnvspeeiv stlkklgsdesvngvfvarpfplgldekeilssvpvekdvegvnpanlglllydeeifppctaeaavri leretnlsgkrvtvvgrsvtvgkplalmllkkgrdatvtvchsrtvnleeitknsdivvvavgrahflk knmvkegaividvginyvdgklqgdvdpsveeiarvtpvpggvgqvttallfehvvraaerqrk
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1767
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch