The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 283492
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2318,TM1635 Molecular Weight 44683.91 Da.
    Residues 385 Isoelectric Point 5.46
    Sequence minlkelkilhtsdwhlgvtswtssrpvdrreelkkaldkvveeaekrevdlilltgdllhsrnnpsvv alhdlldylkrmmrtapvvvlpgnhdwkglklfgnfvtsissditfvmsfepvdveakrgqkvrilpfp ypdesealrknegdfrfflesrlnklyeealkkedfaifmghftveglagyagieqgreiiinralips vvdyaalghihsfreiqkqpltiypgsliridfgeeadekgavfvelkrgeppryeridasplplktly ykkidtsalksirdfcrnfpgyvrvvyeedsgilpdlmgeidnlvkierksrreieevlrespeefkee ldkldyfelfkeylkkreenhekllkildelldevkksea
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch