The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 283323
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2278,TM1465, _0000.000001_, 89372, 89419 Molecular Weight 18985.98 Da.
    Residues 170 Isoelectric Point 5.99
    Sequence mkgyihvytgngkgkttaalglatraacaglkvffgqflkgretselkiseflpnfeivqygtpefivg npseeqikkaksgladakerlvsekydvvvldelcvaihlglfskeeiedllnvkpenvelvitgryap ewliekadlvtemkevkhyyqkgvvarkgiey
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Model TM1465
    generated 12/2008
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch