.
The Open Protein Structure Annotation Network
PDB Keyword
.

282703

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Crystallized
    Target Id 282703
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2150,TM0833 Molecular Weight 72424.00 Da.
    Residues 636 Isoelectric Point 6.41
    Sequence mekysaesikvlkglepvrmrpgmyigstgkrglhhlvyevvdnsvdealagycdwirvtlhedgsvev edngrgipvdihpeegrsalevvftvlhaggkfskdsykisgglhgvgvsvvnalsewlevrvhrdgki yrqryergkpvtpvevigetdkhgtivrfkpdplifsetefdpdilehrlreiaflvpglkiefedrin gekktfkfdggiveyvkylnrgkkalhdvihikrtekvktkngedeviveiafqytdsysedivsfant iktvdggthvtafkstltrlmneygkkhnflkkddsfqgedvregltavisvyvknpefegqtksklgn eevkeavtkamreelkkifdanpelvktilskimstkqareaakraremvrrknvlqnttlpgkladcs sthrektelfivegdsaggsakqardrefqavlpirgkilnvekssldrllkneqisdiivavgtgigd dfdesklrygriiimtdadidgahirtllltlfyrymrplieqgrvyialpplyrikagreefyvysdq elaeykeklqgkrieiqrykglgemnpeqlwettmnpetrkiirvtiedaeeadrlfeilmgndpssrr efierhalkvkeldi
      BLAST   FFAS

    Access denied for user 'root'@'localhost' (using password: YES) (click for details)

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0833
    generated 12/2008
    Google Scholar output for

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch