The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282699
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2149,TM0829, 90094, 84895 Molecular Weight 16844.80 Da.
    Residues 150 Isoelectric Point 5.41
    Sequence mrvkdaviydisavfedetvetvikllsrqnlsgvpvvdhdmrvvgfvsesdlikalvpsyfsllrsas fipdtnqlirnvvkikdrpvsefmnkppvvvkeddplivaadylirhgfkslpvvdeamqlvgivrrid ilrvvsegklei
      BLAST   FFAS
    Ligand Information
    Google Scholar output for

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch